PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.292610.1
Common NameCsa_1G109320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 319aa    MW: 36229.3 Da    PI: 8.2043
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.292610.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d + + G+g +W + +++ g++R++k+c++rw++yl
   Cucsa.292610.1 14 KGPWSPEEDAKLKDFIDKNGTGgNWISLPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.71.1e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd ++  ++   G++ W+ Ia  ++ gRt++++k++w++
   Cucsa.292610.1  69 GGFTDEEDRIICTLFSTIGSR-WSIIATQLP-GRTDNDIKNHWNS 111
                      569******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.68962IPR017930Myb domain
SuperFamilySSF466891.64E-2611109IPR009057Homeodomain-like
SMARTSM007171.1E-101364IPR001005SANT/Myb domain
PfamPF002493.9E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231569IPR009057Homeodomain-like
CDDcd001672.01E-71662No hitNo description
PROSITE profilePS5129422.49863117IPR017930Myb domain
SMARTSM007171.6E-1167115IPR001005SANT/Myb domain
PfamPF002495.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2370118IPR009057Homeodomain-like
CDDcd001679.11E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRSPCCDKS NVKKGPWSPE EDAKLKDFID KNGTGGNWIS LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTDEEDRIIC TLFSTIGSRW SIIATQLPGR TDNDIKNHWN SKLKRKLIEM  120
EKKAQITTSR TIPSSHNHHH HQIFSSFSSQ PLSSLINKHD DYFNDINYSN YNLSSPPTTI  180
KSFESLISSI PSNWSNNNNN ISPSPCLVQT QETTNLLSSN SLMYNHHNPL VQMKESCLLG  240
FGSEGSCSSS TSDGRSYTQI NTTSGIMGFQ NNNNNNNPNY YYYYSDNIMN YINHQPAANL  300
EYSYMEDENK TLLENFMY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819280.0LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464692.11e-146PREDICTED: transcription factor RAX2-like
TrEMBLA0A0A0LUZ60.0A0A0A0LUZ6_CUCSA; Uncharacterized protein
STRINGPOPTR_0009s01270.15e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2450233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-75myb domain protein 36
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]